An
Email with the Subject "Dear: good day," was
received in one of Scamdex's honeypot email accounts on Thu, 10 Sep 2009 20:53:56 -0700
and has been classified as a Advance Fee Fraud/419 Scam Email.
The sender shows as Mary Richard <maryrchard@yahoo.co.nz>.
The email address was probably spoofed. Do not reply to or contact any persons or organizations referenced in
this email, or follow any URLs as you may expose yourself to scammers and, at the very least, you will be
added to their email address lists for spam purposes.
Scam TagCloud
generalafricaboxforeignbankcheckcontactsecretaryjobservicepaiddeliverypackagemailbank your bank africa bank maryrchard@yahoo.coupsaccra1@yahoo.cnesq. will securityyahoo.coyahoo.yahoo!treasureblessed(upsaccra1@yahoo.cn)( upsaccra1@yahoo.cn )(esq.)consignmentdear mr michael davidposition... mr. edward van
NO CHART DATA - EMAIL HAS NOT YET BEEN ANALYSED
Scam Email Headers
This a (redacted) view of the raw email headers of this scam email.
Personally Identifiable Information (PII) has been suppressed, but can be
supplied as received to appropriate investigating or law enforcement agencies on request.
Domain Names used for collecting scam email ("Honeypot email accounts") have been obscured and replaced with the token 'HUN1P0T'
Community Action - SPAM/non-Scam Report
Occasionally, incorrectly categorized emails get into the Scamdex Scam Email Database and need to be removed. If this
email has Personally Identifiable Information (PII), or is, in your opinion, from a bona-fide entity, let us know.
Scamdex will, as soon as is practicable, take-down any emails that in our opinion should not
be in our database. Note that ALL emails in the Scamdex Scam Email Database were received as Unsolicited Commercial Email, aka UCE or
SPAM, via unpublished 'Honeypot' email addresses.
I have register your Bank Draft. but the manager of Africa Bank told me that before the check will get to you that it will expire. So i told him to cash $1.500,000.00 all the necessary arrangement of delivering the $1.500,000.00 in cash was made with United Parcel Service ''UPS''. This is the information they need to delivery your package to you. with ''UPS'', contact them now.
BELOW IS THE ''UPS'' INFORMATION'S. NAME: United Parcel Service ''UPS'', ATTANTION: PERSON: Mr Michael David POSITION: FOREIGN DELIVERY DEPARTMENT. E-MAIL: (upsaccra1@yahoo.cn) TELEPHONE: +233 21 300693 Please, Send them your contacts information to able them locate you immediately they arrived in your country with your BOX .This is what
they need from you.
1.YOUR FULL NAME 2..YOUR HOME ADDRESS. 3.YOUR CURRENT HOME TELEPHONE NUMBER. 4.YOUR CURRENT OFFICE TELEPHONE. 5.A COPY OF YOUR PICTURE 6.COMPANY REGISTRATION NO EG58945 7.CODE NUMBER 0140479 8.I have paid for the delivering charges.. The only money you have to send to them is $97 for their Security keeping of your consignment, I was try to pay for that and they was says no due to security reason.
Note that this is there E-mail contact ( upsaccra1@yahoo.cn )
Please make sure you send this needed infoâs to the Director general of United Parcel Service ACCRA-GHANA, MR. EDWARD VAN with the address given to you. Note. The UPS don't know the contents of the Box. I registered it as a Box of an family treasure. They don't know it contents money. this is to avoid anything to happen with the box or delaying. don't let them it contain money OK.
Thanks and Remain
Blessed. Secretary, awudu ibrahim (Esq.)
I have register your Bank Draft. but the manager of Africa Bank told me that before the check will get to you that it will expire. So i told him to cash $1.500,000.00 all the necessary arrangement of delivering the $1.500,000.00 in cash was made with United Parcel Service ''UPS''. This is the information they need to delivery your package to you. with ''UPS'', contact them now.
BELOW IS THE ''UPS'' INFORMATION'S. NAME: United Parcel Service ''UPS'', ATTANTION: PERSON: Mr Michael David POSITION: FOREIGN DELIVERY DEPARTMENT. E-MAIL: (upsaccra1@yahoo.cn) TELEPHONE: +233 21 300693 Please, Send them your contacts information to able them locate you immediately they arrived in your country with your BOX .This is what
they need from you.
1.YOUR FULL NAME 2..YOUR HOME ADDRESS. 3.YOUR CURRENT HOME TELEPHONE NUMBER. 4.YOUR CURRENT OFFICE TELEPHONE. 5.A COPY OF YOUR PICTURE 6.COMPANY REGISTRATION NO EG58945 7.CODE NUMBER 0140479 8.I have paid for the delivering charges.. The only money you have to send to them is $97 for their Security keeping of your consignment, I was try to pay for that and they was says no due to security reason.
Note that this is there E-mail contact ( upsaccra1@yahoo.cn )
Please make sure you send this needed infoâs to the Director general of United Parcel Service ACCRA-GHANA, MR. EDWARD VAN with the address given to you. Note. The UPS don't know the contents of the Box. I registered it as a Box of an family treasure. They don't know it contents money. this is to avoid anything to happen with the box or delaying. don't let them it contain money OK.
Thanks and Remain
Blessed. Secretary, awudu ibrahim (Esq.)
Reading this email at work? Make a change with Yahoo!Xtra Jobs