An
Email with the Subject "contact rain coker" was
received in one of Scamdex's honeypot email accounts on Fri, 06 Jun 2008 20:26:58 -0400
and has been classified as a Generic Scam Email.
The sender shows as "BARRISTER MATHEW" <barrismatt100@netcabo.pt>.
The email address was probably spoofed. Do not reply to or contact any persons or organizations referenced in
this email, or follow any URLs as you may expose yourself to scammers and, at the very least, you will be
added to their email address lists for spam purposes.
Scam TagCloud
nigeriaafrican234 807 9128 atm thousand barristersoldcontactwinsafejoyaccount thousandpaymentserviceaccessprocessiraqfund transferpaiddeliverypackagemailusddollarfedexdeliveryservicenig1@... will securityblessedach(0114)(twenty thousand united s... master card worth master card has master card inside, master card withdrewing mr rain coker
NO CHART DATA - EMAIL HAS NOT YET BEEN ANALYSED
Scam Email Headers
This a (redacted) view of the raw email headers of this scam email.
Personally Identifiable Information (PII) has been suppressed, but can be
supplied as received to appropriate investigating or law enforcement agencies on request.
EEEEEstdClass Object
(
[return-path:] =>
[received:] => Array
(
[0] => from rly-df05.mx.aol.com (rly-df05.mail.aol.com [172.19.156.18]) by air-df04.mail.aol.com (v121.4) with ESMTP id MAILINDF043-54e4849d5c52f7; Fri, 06 Jun 2008 20:26:58 -0400
[1] => from exch01smtp10.hdi.tvcabo (smtp4.netcabo.pt [212.113.174.31]) by rly-df05.mx.aol.com (v121.5) with ESMTP id MAILRELAYINDF053-54e4849d5c52f7; Fri, 06 Jun 2008 20:26:46 -0400
[2] => from VS3.hdi.tvcabo ([10.137.130.37]) by exch01smtp10.hdi.tvcabo with Microsoft SMTPSVC(6.0.3790.3959); Sat, 7 Jun 2008 01:26:45 +0100
)
[content-class:] => urn:content-classes:message
[mime-version:] => 1.0
[content-type:] => multipart/alternative;boundary="----_=_NextPart_001_01C8C835.17261354"
[x-mimeole:] => Produced By Microsoft Exchange V6.5
[subject:] => contact rain coker
[date:] => Sat, 7 Jun 2008 01:26:12 +0100
[message-id:] =>
[x-ms-has-attach:] =>
[x-ms-tnef-correlator:] =>
[thread-topic:] => contact rain coker
[thread-index:] => AcjINRbSugWkqryUQxSq/pXOrZP19w==
[from:] => "BARRISTER MATHEW"
[x-originalarrivaltime:] => 07 Jun 2008 00:26:45.0203 (UTC) FILETIME=[2A81CA30:01C8C835]
[x-aol-ip:] => 212.113.174.31
[x-aol-scoll-authentication:] => Array
(
[0] => domain : exch01smtp10.hdi.tvcab ; SPF_helo =
[1] => domain : netcabo.p ; SPF_822_from =
)
[to:] => undisclosed-recipients:;
[x-mailer:] => Unknown (No Version)
[x-scamdex-scores:] => S:69 P:56 A:60 L:54 E:61 G:53
[x-scamdex-classtype:] => S
[x-scamdex-classscore:] => 69
[x-scamdex-totscore:] => 353
[x-scamdex-kw:] => Bless,access,account,africa,barrister,card,contact,dollars,fund,nigeria,package,paid,payment,process,safe,service,sold,trust
[x-scamdex-em:] => fedexdeliveryservicenig1@live.com
[x-scamdex-dir:] => C
[x-scamdex-id:] => C1240709738.M491991P12761V
[x-scamdex-copyright:] => This Email is Copyright Scamdex.com 2009, Reproduction Prohibited
)
Domain Names used for collecting scam email ("Honeypot email accounts") have been obscured and replaced with the token 'HUN1P0T'
Community Action - SPAM/non-Scam Report
Occasionally, incorrectly categorized emails get into the Scamdex Scam Email Database and need to be removed. If this
email has Personally Identifiable Information (PII), or is, in your opinion, from a bona-fide entity, let us know.
Scamdex will, as soon as is practicable, take-down any emails that in our opinion should not
be in our database. Note that ALL emails in the Scamdex Scam Email Database were received as Unsolicited Commercial Email, aka UCE or
SPAM, via unpublished 'Honeypot' email addresses.
I wish to inform that I have dropped an ATM MASTER CARD worth $800,000 USD with FedEx Delivery Services.Everything has been paid both Insurance and delivery charges have been paid for, but the only fee remaining is the security safe keeping fee of $300 USD which you will be required to pay before delivery. I did this because I was unable to make the funds transfer to your home account in your country and I am going out of Nigeria to Iraq for a period of 4 months to see my boss.i really dont have money to pay because have spent alot processing this package for you.it came to an extent that sold my television set at all.try and come up with the security fee so that your percel will be deliver to you my friend please dont let your percel go like that. this for real trust me
However, this was not paid for because of demurrage. Well, I did forward them your delivery address, but a re-confirmation is important and when contacting, I advise you quote the parcel and shipment code to them for onward delivery to your re-confirmed address. The ATM MASTER CARD has pin number (0114). Please make sure the information is complete as they promised that once they receive their security safe keeping fee within 2 to 3 working days the magazine will arrived your door step according to the shipment officer
Forward the following when contacting FedEx Delivery Services:
Your Name, Your Delivery Address, Your Phone Number and code below.call for help Once again, the Fedex delivery services do not know the content of the parcel, I registered it as an African magazine they don't know it contains ATM MASTER CARD inside, this is to avoid them delaying the delivery and besides I don't want you to lose your inherittance funds.
Your ATM MASTER CARD withdrewing access pin code number is (0114) take note, once you receive the card you take it to any cashpoint around your area and sllotten it and enter the pin code for withdrewal, the amount you are to withdrew per day is USD$20,000.00. (Twenty thousand United State dollars) each day. Also ask them on how you are to make the payment for the security fee to them so they can effect immedaite delivery on your parcel.
Remain blessed and enjoy your funds.
Find FedEx Contact Information Below: ==================================== Contact Mr Rain Coker Shipment Officer Of Fedex delivery services E-mail:fedexdeliveryservicenig1@live.com
Goodday,
I wish to inform that I have dropped an ATM MASTER CARD worth $800,000 USD with FedEx Delivery Services.Everything has been paid both Insurance and delivery charges have been paid for, but the only fee remaining is the security safe keeping fee of $300 USD which you will be required to pay before delivery. I did this because I was unable to make the funds transfer to your home account in your country and I am going out of Nigeria to Iraq for a period of 4 months to see my boss.i really dont have money to pay because have spent alot processing this package for you.it came to an extent that sold my television set at all.try and come up with the security fee so that your percel will be deliver to you my friend please dont let your percel go like that. this for real trust me
However, this was not paid for because of demurrage. Well, I did forward them your delivery address, but a re-confirmation is important and when contacting, I advise you quote the parcel and shipment code to them for onward delivery to your re-confirmed address. The ATM MASTER CARD has pin number (0114). Please make sure the information is complete as they promised that once they receive their security safe keeping fee within 2 to 3 working days the magazine will arrived your door step according to the shipment officer
Forward the following when contacting FedEx Delivery Services:
Your Name, Your Delivery Address, Your Phone Number and code below.call for help Once again, the Fedex delivery services do not know the content of the parcel, I registered it as an African magazine they don't know it contains ATM MASTER CARD inside, this is to avoid them delaying the delivery and besides I don't want you to lose your inherittance funds.
Your ATM MASTER CARD withdrewing access pin code number is (0114) take note, once you receive the card you take it to any cashpoint around your area and sllotten it and enter the pin code for withdrewal, the amount you are to withdrew per day is USD$20,000.00. (Twenty thousand United State dollars) each day. Also ask them on how you are to make the payment for the security fee to them so they can effect immedaite delivery on your parcel.
Remain blessed and enjoy your funds.
Find FedEx Contact Information Below: ==================================== Contact Mr Rain Coker Shipment Officer Of Fedex delivery services E-mail:fedexdeliveryservicenig1@live.com
Tel: +234 807 9128 582 Shipment Code: CPEL/OWN/9876 Parcel Number: EG2272 Thanks. Barrister Mathew
