An
Email with the Subject "Fw: Notification of Limited Account Access = SCAM SUBJECT, SENDER AND MESSAGE" was
received in one of Scamdex's honeypot email accounts on Fri, 27 Jun 2008 09:30:24 -0700
and has been classified as a Generic Scam Email.
The sender shows as "Senta Setinc" <senta.setinc@triera.net>.
The email address was probably spoofed. Do not reply to or contact any persons or organizations referenced in
this email, or follow any URLs as you may expose yourself to scammers and, at the very least, you will be
added to their email address lists for spam purposes.
Scam TagCloud
paypalcreditactivitycheckwinsafeaccountnotificationserviceinc.accesssecureverifysentonlinemailsincerely will (service@pp.com)(as you can see below)dear
NO CHART DATA - EMAIL HAS NOT YET BEEN ANALYSED
Scam Email Headers
This a (redacted) view of the raw email headers of this scam email.
Personally Identifiable Information (PII) has been suppressed, but can be
supplied as received to appropriate investigating or law enforcement agencies on request.
EEEEEstdClass Object
(
[return-path:] =>
[envelope-to:] => scams@scamdex.com
[delivery-date:] => Fri, 27 Jun 2008 09:30:24 -0700
[received:] => Array
(
[0] => from deliver-2.mx.triera.net ([213.161.0.32])by gogol.o7e.net with esmtp (Exim 4.69)(envelope-from )id 1KCGq6-0000Il-7gfor scams@scamdex.com; Fri, 27 Jun 2008 09:30:24 -0700
[1] => from localhost (unknown [213.161.0.24])by deliver-2.mx.triera.net (Postfix) with ESMTP id 63C734A3for ; Fri, 27 Jun 2008 18:29:49 +0200 (CEST)
[2] => from smtp.triera.net (smtp.triera.net [213.161.0.30])by in-6.mx.triera.net (Postfix) with SMTP id 42FB01AA5A9for ; Fri, 27 Jun 2008 18:29:53 +0200 (CEST)
[3] => from home02ba1bb308 (cpe1-5-248.cable.triera.net [213.161.5.248])by smtp.triera.net (Postfix) with SMTP id F3C481A18AAfor ; Fri, 27 Jun 2008 18:29:54 +0200 (CEST)
)
[x-virus-scanned:] => Triera AV Service
[x-mailer:] => Array
(
[0] => <003b01c8d873$086785e0$f805a1d5@home02ba1bb308>
[1] => Microsoft Outlook Express 6.00.2900.3138
)
[from:] => "Senta Setinc"
[to:] =>
[subject:] => Fw: Notification of Limited Account Access = SCAM SUBJECT, SENDER AND MESSAGE
[date:] => Fri, 27 Jun 2008 18:29:55 +0200
[mime-version:] => 1.0
[content-type:] => multipart/alternative;boundary="----=_NextPart_000_0038_01C8D883.CBC7E650"
[x-priority:] => 1
[x-msmail-priority:] => High
[x-mimeole:] => Produced By Microsoft MimeOLE V6.00.2900.3198
[x-antivirus:] => avast! (VPS 080626-1, 26.06.2008), Outbound message
[x-antivirus-status:] => Clean
[x-spam-status:] => No, score=1.0
[x-spam-score:] => 10
[x-spam-bar:] => +
[x-spam-flag:] => NO
[message-id:] => REIDs3x1239839798.M353765P32690V-S3X
[x-scamdex-scores:] => S:74 P:81 A:84 L:70 E:81 G:67
[x-scamdex-classtype:] => A
[x-scamdex-classscore:] => 84
[x-scamdex-totscore:] => 457
[x-scamdex-kw:] => access,account,activity,card,check,credit,first,from home,inc.,log in,login,notification,paypal,safe,sent,service,verify
[x-scamdex-em:] => service@paypal.com,service@pp.com,setinc@triera.net
[x-scamdex-dir:] => B
[x-scamdex-id:] => B1239839798.M353765P32690V
[x-scamdex-copyright:] => This Email is Copyright Scamdex.com 2009, Reproduction Prohibited
)
Domain Names used for collecting scam email ("Honeypot email accounts") have been obscured and replaced with the token 'HUN1P0T'
Community Action - SPAM/non-Scam Report
Occasionally, incorrectly categorized emails get into the Scamdex Scam Email Database and need to be removed. If this
email has Personally Identifiable Information (PII), or is, in your opinion, from a bona-fide entity, let us know.
Scamdex will, as soon as is practicable, take-down any emails that in our opinion should not
be in our database. Note that ALL emails in the Scamdex Scam Email Database were received as Unsolicited Commercial Email, aka UCE or
SPAM, via unpublished 'Honeypot' email addresses.
A few days ago I received a suspicious
message from people who called themselves as PayPal Service. The sender
address (service@pp.com) was not the one I knew as the address of the PP
Service, so I checked with the REAL PayPal (as you can see below), but did not
receive any answer from them so far. Maybe you know more? Below is the dubious
message from even more dubious PayPal service people.
Subject: Re: Notification of Limited Account Access
Dear PayPal Service Team,
I have just received this message (see
below) and since the from-address (service@pp.com) differs from the one I already
know as being the e-mail address of the PayPal Service, I just wanted to check
with you the validity and credibility of the message, before I follow the
instructions in the message to provide my credit card number and other details.
I shall be waiting for your answer. Thank you!
Best regards, Senta Šetinc
Dear SCAMDEX,
A few days ago I received a suspicious
message from people who called themselves as PayPal Service. The sender
address (service@pp.com) was not the one I knew as the address of the PP
Service, so I checked with the REAL PayPal (as you can see below), but did not
receive any answer from them so far. Maybe you know more? Below is the dubious
message from even more dubious PayPal service people.
Thank you and Kind regards,
Senta Setinc
----- Original Message -----
From: Senta
Setinc
To: PAYPAL SERVICE
Sent: Sunday, June 22, 2008 12:11 PM
Subject: Re: Notification of Limited Account Access
Dear PayPal Service Team,
I have just received this message (see
below) and since the from-address (service@pp.com) differs from the one I already
know as being the e-mail address of the PayPal Service, I just wanted to check
with you the validity and credibility of the message, before I follow the
instructions in the message to provide my credit card number and other details.
I shall be waiting for your answer. Thank you!
Best regards, Senta Šetinc
----- Original Message -----
From:
PayPal
To: undisclosed-recipients:
Sent: Sunday, June 22, 2008 8:09 AM
Subject: Notification of Limited Account
Access
Dear PayPal Member,
As
part of our efforts to provide
a safe and secure environment
for the online community, we
regularly screen account activity. While
reviewing your PayPal accounts, we
observed activity that we would
like to further verify. For
this reason, limitations have been
placed on your account until
your will review your registered
intormation. In order to resolve the
account limitations, complete our
online form by clicking on the
following link :
Log
into your PayPal
account
After we have
gathered the necessary information,
your account will be reviewed
for reinstatement and you will
be notified by e-mail of our
decision.
We thank you for
your prompt attention to this
matter and apologize for any
inconvenience.
