An
Email with the Subject "Fw: You are to send the endorsement activation charges" was
received in one of Scamdex's honeypot email accounts on Wed, 10 Jun 2009 07:11:45 -0700
and has been classified as a Generic Scam Email.
The sender shows as Michael <wdalaskan@yahoo.com>.
The email address was probably spoofed. Do not reply to or contact any persons or organizations referenced in
this email, or follow any URLs as you may expose yourself to scammers and, at the very least, you will be
added to their email address lists for spam purposes.
Scam TagCloud
bellobeneficiaryfinance(503) 906-1015(503) 906-1059(503) 906-10631-800-325-6000bankwestern unionwesternunioncheckcontactaccountclaimglobalpaymentresponseinternetaccessfund transferurgentpaidmailbank usd thatyour bank the bank ofyour bank mtcnreferencesincerelywdalaskan@yahoo.com will godyahoo.com(503)($15,000)(available for pick up)co-operation
NO CHART DATA - EMAIL HAS NOT YET BEEN ANALYSED
Scam Email Headers
This a (redacted) view of the raw email headers of this scam email.
Personally Identifiable Information (PII) has been suppressed, but can be
supplied as received to appropriate investigating or law enforcement agencies on request.
EEEEEstdClass Object
(
[return-path:] =>
[envelope-to:] => scams@scamdex.com
[delivery-date:] => Wed, 10 Jun 2009 07:11:45 -0700
[received:] => Array
(
[0] => from web50005.mail.re2.yahoo.com ([206.190.38.20])by fire.newsblaze.com with smtp (Exim 4.69)(envelope-from )id 1MEOWg-0002Gj-VIfor scams@scamdex.com; Wed, 10 Jun 2009 07:11:45 -0700
[1] => (qmail 33384 invoked by uid 60001); 10 Jun 2009 14:11:36 -0000
[2] => from [208.187.191.118] by web50005.mail.re2.yahoo.com via HTTP; Wed, 10 Jun 2009 07:11:36 PDT
)
[dkim-signature:] => v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s1024; t=1244643096; bh=8bnRRXPjdbJCxs2dtdEHe9TZGGvJRjzzqDV5V6oAkL4=; h=Message-ID:X-YMail-OSG:Received:X-Mailer:Date:From:Subject:To:MIME-Version:Content-Type; b=w9JC1Bn2BBosPg0vGT76qYEgv4IR3kb/c5I3bsW4papbV2H0SL6CPO8dA6TlFvqOEKnmmJVhQPEZYI8ttCgGbaoHMjwpl6op8K+ZE+cbumEstMEYfGdlmZaPDroAHvhkb8RAehEpj6xqwBkjZLHrdaAnEYmbdM7HwlFQzhqbJjE=
[domainkey-signature:] => a=rsa-sha1; q=dns; c=nofws; s=s1024; d=yahoo.com; h=Message-ID:X-YMail-OSG:Received:X-Mailer:Date:From:Subject:To:MIME-Version:Content-Type; b=aWYwINt9KhBq0c6xqYilBTYoyN/9aFzKT8O8eRVWGXVNHbOdHsNnaPAlPgq6r6vG2WDw8TntDgjZJgk33qkelbX0qekw66bg1dXWSpYrbunwJML59VRj8KFAic3C+sMbt1eAApkCnLjmXd8ylBMasrNa92SzYWwamYQRJX5oe6I=;
[message-id:] => <588674.32202.qm@web50005.mail.re2.yahoo.com>
[x-ymail-osg:] => SI0FQxQVM1kOPmBi7MmHO8b36CwK6Z5aTRdbli5g06tLxUt06c.hw6YcB7cGkL_j6vGV0MOCaWQHQdlVDGN.pb4w7IFykWXndEYLZJkr6_0fYaE2.Ko21JQRZVeGZS3C2onynH59FvzP7sidDVPwm1vNOojIrK5fyMBA0ECdjCysFIW0LuTiI4k2AsqHVifYb5yPBkdFdB1zeT8c0v2NJ_HI3xd2S2IeWLsodx5hZG6LCGiBHME8QaANpTVZtO7_pY7xtKgoObNUl2LmXcMU8Oqd2Ncxeyt5RwQvH3h8rm9hnXcen64ePqmyd8f98rVRLHAx61tLqYoJxAekYbD_yxB6xGM2VTAAn6Gfg_YCExv8APSsfm_PxY7wdALkt.Y-
[x-mailer:] => YahooMailClassic/5.4.12 YahooMailWebService/0.7.289.15
[date:] => Wed, 10 Jun 2009 07:11:36 -0700 (PDT)
[from:] => Michael
[subject:] => Fw: You are to send the endorsement activation charges
[to:] => SCAM/FRAUD , SCAMS , SCAMS
[mime-version:] => 1.0
[content-type:] => multipart/alternative; boundary="0-659870486-1244643096=:32202"
[x-spam-status:] => No, score=1.0
[x-spam-score:] => 10
[x-spam-bar:] => +
[x-spam-flag:] => NO
[x-scamdex-scores:] => S:73 P:59 A:69 L:61 E:65 G:56
[x-scamdex-classtype:] => S
[x-scamdex-classscore:] => 73
[x-scamdex-totscore:] => 383
[x-scamdex-kw:] => transfer,God,MTCN,access,account,bank,beneficiary,check,claim,contact,finance,first,fund,global,inc.,internet,paid,payment,response,service,union,urgent,western
[x-scamdex-em:] => 3DmrsleoWood@kelebek.gen.tr,info@Compens,info@CompensationFina,mrsleoWood@kelebek.gen.tr,mrsleoWood@kelebek.gen.trAT
[x-scamdex-dir:] => D
[x-scamdex-id:] => D1244643105.H956041P8783
[x-scamdex-copyright:] => This Email is Copyright Scamdex.com 2009, Reproduction Prohibited
)
Domain Names used for collecting scam email ("Honeypot email accounts") have been obscured and replaced with the token 'HUN1P0T'
Community Action - SPAM/non-Scam Report
Occasionally, incorrectly categorized emails get into the Scamdex Scam Email Database and need to be removed. If this
email has Personally Identifiable Information (PII), or is, in your opinion, from a bona-fide entity, let us know.
Scamdex will, as soon as is practicable, take-down any emails that in our opinion should not
be in our database. Note that ALL emails in the Scamdex Scam Email Database were received as Unsolicited Commercial Email, aka UCE or
SPAM, via unpublished 'Honeypot' email addresses.
--- On Tue, 6/9/09, Compensation Finance House <info@CompensationFinanceHouse.org> wrote:
Thank you,
Michael Hernandez
AG Specialties LLC.
(503) 906-1015
(503) 906-1059 direct line
(503) 906-1063 fx
--- On Tue, 6/9/09, Compensation Finance House <info@CompensationFinanceHouse.org> wrote:
From: Compensation Finance House <info@CompensationFinanceHouse.org> Subject: You are to send the endorsement activation charges To: Date: Tuesday, June 9, 2009, 1:06 PM
Compensation Finance House, 14 Mountfield Road Ealing, London, W5 2 NG United Kingdom
email: mrsleoWood@kelebek.gen.tr
ATTN: Firstly, I must start by apologizing for the delay in response to you and for not contacting you since the beginning of the New Year. This email is coming to you in regards to your fund that you have been unable to claim due to your lack of co-operation in the past.
This organization has decided to make it know to you that your bank draft has been cleared and that you will be receiving your fund
through the fastest means of money transfer in the world. Since you have not been able to claim you fund that has been with us for a very long time, we have to call back for the Bank Draft
and make arrangement
alternatively to transfer your fund install mentally through Western Union Money Transfer here today which
has been programmed to be transferred under installment at rate of $15,000 daily as Western Union laws here does not allow
transferring funds above $15,000 at once from this country to another, but we will be sending under installment of $15,000 daily till the
amount of $250.000.00usd is completely Paid to you as the beneficiary of the Bank Draft in questioned.
In other words, We have today transferred your first installment payment ($15,000) available for your pickup at any western union
office nearest to you, but still on hold due to the unpaid endorsement & daily activation file fee amount of $350.00 that you are
supposed to pay before your daily transfer will be made available to you. You will pickup the bellow installment at any western union
office
nearest to you with bellow information's as soon as you submit the $350 endorsement & daily activation file fee. Once the
activation is made , you can track your first installment payment with the Western Union tracking number 1-800-325-6000 or through
the western union global website so as for you to know that the money is available for pick up (but will not be released you without the
file activation Payment information Sender Name: Micheal Coleman Receivers Name: MTCN: 115-041-0071 (Available For Pick Up) Text Question: Sport? Answer: Golf Amount Programmed: $15,000 The endorsement & daily activation file fee of $350 will be sending to our office here in care to our accounting officer through Western
Union Money Transfer nearest to you.
You are to send the endorsement activation charges with the information below.
Receive by: John
Adams Address: 14 Mountfield Road Ealing, London, W5 2 NG City & Country:United Kingdom Amount: $350 Text Question: Good Answer: God.
As soon as you send the fee, send us the transfer Mtcn/Reference # to help us proceed with immediate transfer activation of your
first installment payment.
Notice: This preference is being given to you to our good name and also to make sure we get your fund paid to you with no
complication of things or delay.
Note: the Activation Fees could not be deducted from the Bank Draft fund here, as we have no access to the fund due to the Fact
that it was placed in a Bank Draft/Check and not cash at hand.
Please submit your Activation charges with the name of our accounting officer as given to you and get back to this office with details
of your payment for further actions here. To avoid complication of things, you
are advise to treat this payment as urgent as possible so we can proceed with the activation of
your first installment so you can get it picked up in any nearest Western Union Money Transfer outlet near you on time to avoid any
internet scam hacking of the Mtcn that is given to you above.
Please Note: the total amount that will be paid to you weekly is totaled: USD$105,000.00 till the total amount of your Bank Draft fund is
completely paid.
Treat As Urgent and get back to this office with receipt of your payment for fast procedures here. Thanking you for your Anticipated Co-operations.
Sincerely, Micheal Coleman Administrative Department, Compensation Finance House