An
Email with the Subject "Fwd: YOUR E-MAIL ACCOUNT HAS WON!" was
received in one of Scamdex's honeypot email accounts on Fri, 10 Oct 2008 07:15:50 -0700
and has been classified as a Generic Scam Email.
The sender shows as michael hernandez <wdalaskan@yahoo.com>.
The email address was probably spoofed. Do not reply to or contact any persons or organizations referenced in
this email, or follow any URLs as you may expose yourself to scammers and, at the very least, you will be
added to their email address lists for spam purposes.
Scam TagCloud
hundred thousand united ...endedprizewindrawlotterylottonumbersnationalcongratulationsawardclaimsclaimticketagentfive hundred thousandfundmailusddollarbatchconfidentialreferencecategorymrwallace_desk202@yahoo.cn will yahoo.
NO CHART DATA - EMAIL HAS NOT YET BEEN ANALYSED
Scam Email Headers
This a (redacted) view of the raw email headers of this scam email.
Personally Identifiable Information (PII) has been suppressed, but can be
supplied as received to appropriate investigating or law enforcement agencies on request.
EEEEEstdClass Object
(
[return-path:] =>
[envelope-to:] => scams@scamdex.com
[delivery-date:] => Fri, 10 Oct 2008 07:15:50 -0700
[received:] => Array
(
[0] => from web50003.mail.re2.yahoo.com ([206.190.38.18])by gogol.o7e.net with smtp (Exim 4.69)(envelope-from )id 1KoImS-0006tb-7gfor scams@scamdex.com; Fri, 10 Oct 2008 07:15:50 -0700
[1] => (qmail 50865 invoked by uid 60001); 10 Oct 2008 14:15:48 -0000
[2] => from [208.187.191.118] by web50003.mail.re2.yahoo.com via HTTP; Fri, 10 Oct 2008 07:15:47 PDT
)
[domainkey-signature:] => a=rsa-sha1; q=dns; c=nofws; s=s1024; d=yahoo.com; h=X-YMail-OSG:Received:Date:From:Subject:To:MIME-Version:Content-Type:Content-Transfer-Encoding:Message-ID; b=Pm1I+do5NQBCiRKfuvkpkkUxnrJUtvD4suCN0h9fNDpPmWvvX8OsNfyF1vCy56q6GaabVIFOqgliltlCYB9uf61fM4DiE9qnGRXNS+142HilcLhKc1HBwrEsuyMmRtrKozKcOaEVHNFJDwVU0xtzHF3+T39Vcgg87pkE44fdxOg=;
[x-ymail-osg:] => DrdMmYEVM1nxaMkP5rAfWdZUrDX4mPtPs1lktq9Gr75qoscb.ukFLhvd
[date:] => Fri, 10 Oct 2008 07:15:47 -0700 (PDT)
[from:] => michael hernandez
[subject:] => Fwd: YOUR E-MAIL ACCOUNT HAS WON!
[to:] => SCAM/FRAUD , SCAMS , SCAMS
[mime-version:] => 1.0
[content-type:] => multipart/mixed; boundary="0-1443000385-1223648147=:50110"
[content-transfer-encoding:] => 8bit
[x-mailer:] => <164770.50110.qm@web50003.mail.re2.yahoo.com>
[x-spam-status:] => No, score=-7.7
[x-spam-score:] => -76
[x-spam-bar:] => -------
[x-spam-flag:] => NO
[message-id:] => REIDs3x1239839807.M793125P32690V-S3X
[x-scamdex-scores:] => S:114 P:102 A:110 L:129 E:103 G:95
[x-scamdex-classtype:] => L
[x-scamdex-classscore:] => 129
[x-scamdex-totscore:] => 653
[x-scamdex-kw:] => 000,000,000.000,account,agent,award,ballot,certified,claim,claims,congratulations,contact,credit,die,dollars,electronic,ended,fund,hundred thousand,inc.,internet,lottery,lotto,lucky,million,national,notification,numbers,prize,process,promotion,report,resident,sold,staff,ticket,united states dollar,verification,winn,won
[x-scamdex-em:] => SMSJ30@aol.com,mrwallace_desk202@yahoo.cn,wdalaskan@yahoo.com
[x-scamdex-dir:] => B
[x-scamdex-id:] => B1239839807.M793125P32690V
[x-scamdex-copyright:] => This Email is Copyright Scamdex.com 2009, Reproduction Prohibited
)
Domain Names used for collecting scam email ("Honeypot email accounts") have been obscured and replaced with the token 'HUN1P0T'
Community Action - SPAM/non-Scam Report
Occasionally, incorrectly categorized emails get into the Scamdex Scam Email Database and need to be removed. If this
email has Personally Identifiable Information (PII), or is, in your opinion, from a bona-fide entity, let us know.
Scamdex will, as soon as is practicable, take-down any emails that in our opinion should not
be in our database. Note that ALL emails in the Scamdex Scam Email Database were received as Unsolicited Commercial Email, aka UCE or
SPAM, via unpublished 'Honeypot' email addresses.
FROM THE DESK OF THE DIRECTOR INTERNATIONAL PRIZE AWARD DEPT.
*Ref Number: PW EH 9590 OG 0612
*Batch Number: 563881545-NL/2008
*Ticket Number: PA 3502 /8707-01
*Winning Amount : $2,500,000.00.USD
Attn: Lucky Winner,
WINNING NOTIFICATION FOR CATEGORY "A" WINNERS ONLY We are pleased to inform you of the result of the last final annual draw of our
Lottery International Programs.
The online cyber lotto draws was conducted from an exclusive list of 25,000,000 e-mail addresses of individual and corporate bodies picked
by an advanced automated random computer search from the internet. No tickets were sold.
CONGRATULATIONS!!!
After this automated computer ballot, your e-mail address emerged as a winner in the category "A" with the following numbers
attached Ref Number: EH 9590 OG 0612, Batch Number: 563881545-NL/2008 and Ticket Number: PA 3502 /8707-01.
You are therefore to receive a cash prize of $2,500,000.00.USD (Two Million Five Hundred Thousand United States Dollars) from the total payout.
CONGRATULATIONS!!!. Your prize award has been insured with your e-mail address and will be transferred to you upon meeting our requirements,
statutory obligations, verifications, validations and satisfactory report. To file in for the processing of your prize winnings, you are advised to contact our certified
and accredited claims agent for category "A" winners with the information below:
***********************************************
CLAIMS AGENT
Name : Barry Wallace
Tel: +316-199-647-91
Fax: +31-84-719-7479
E-mail : mrwallace_desk202@yahoo.cn
***********************************************
You are advised to provide him with the following information:
NOTE: All winnings must be claimed no later than 14 days, thereafter unclaimed funds would be included in the next stake.
Remember to quote your reference information in all correspondence.
You are to keep all lotto information confidential, especially your reference and ticket numbers.
(This is important as a case of double claims will not be entertained).
Members of the affiliate agencies are automatically not allowed to participate in this program.
Furthermore, should there be any change of address do inform our agent as soon as possible.
Congratulations once more from our members of staff and thank you for being part of our promotional program.
Yours Faithfully,
Dr. Hardley Van Brandon,
Award Co-ordinator.
Thank you and congratulations!!!
*This email may contain information which is confidential and/or privileged. The information is intended solely for the use of the individual
or entity named above. If you are not the intended recipient, be aware that any disclosure, copying, distribution or use of the contents is Prohibited.
If you have received this electronic transmission in error,
please notify the sender by telephone or return email and delete the material from your computer.
McCain or Obama? Stay updated on coverage of the Presidential race while you browse - Download Now!
FROM THE DESK OF THE DIRECTOR INTERNATIONAL PRIZE AWARD DEPT.
*Ref Number: PW EH 9590 OG 0612
*Batch Number: 563881545-NL/2008
*Ticket Number: PA 3502 /8707-01
*Winning Amount : $2,500,000.00.USD
Attn: Lucky Winner,
WINNING NOTIFICATION FOR CATEGORY "A" WINNERS ONLY We are pleased to inform you of the result of the last final annual draw of our
Lottery International Programs.
The online cyber lotto draws was conducted from an exclusive list of 25,000,000 e-mail addresses of individual and corporate bodies picked
by an advanced automated random computer search from the internet. No tickets were sold.
CONGRATULATIONS!!!
After this automated computer ballot, your e-mail address emerged as a winner in the category "A" with the following numbers
attached Ref Number: EH 9590 OG 0612, Batch Number: 563881545-NL/2008 and Ticket Number: PA 3502 /8707-01.
You are therefore to receive a cash prize of $2,500,000.00.USD (Two Million Five Hundred Thousand United States Dollars) from the total payout.
CONGRATULATIONS!!!. Your prize award has been insured with your e-mail address and will be transferred to you upon meeting our requirements,
statutory obligations, verifications, validations and satisfactory report. To file in for the processing of your prize winnings, you are advised to contact our certified
and accredited claims agent for category "A" winners with the information below:
***********************************************
CLAIMS AGENT
Name : Barry Wallace
Tel: +316-199-647-91
Fax: +31-84-719-7479
E-mail : mrwallace_desk202@yahoo.cn
***********************************************
You are advised to provide him with the following information:
Names:
Tel/Fax Number:
Nationality:
Occupation:
Age:
NOTE: All winnings must be claimed no later than 14 days, thereafter unclaimed funds would be included in the next stake.
Remember to quote your reference information in all correspondence.
You are to keep all lotto information confidential, especially your reference and ticket numbers.
(This is important as a case of double claims will not be entertained).
Members of the affiliate agencies are automatically not allowed to participate in this program.
Furthermore, should there be any change of address do inform our agent as soon as possible.
Congratulations once more from our members of staff and thank you for being part of our promotional program.
Yours Faithfully,
Dr. Hardley Van Brandon,
Award Co-ordinator.
Thank you and congratulations!!!
*This email may contain information which is confidential and/or privileged. The information is intended solely for the use of the individual
or entity named above. If you are not the intended recipient, be aware that any disclosure, copying, distribution or use of the contents is Prohibited.
If you have received this electronic transmission in error,
please notify the sender by telephone or return email and delete the material from your computer.
McCain or Obama? Stay updated on coverage of the Presidential race while you browse - Download Now!
--- End Message ---