bpmobilcontactwinlotterydrawpromotionnationalluckyclaimsclaimticketagentpaymentfundonlinemailgbpeurobatchreference will achdearnmrs. mable anderson
NO CHART DATA - EMAIL HAS NOT YET BEEN ANALYSED
Scam Email Headers
This a (redacted) view of the raw email headers of this scam email. Personally Identifiable Information (PII) has been suppressed, but can be
supplied as received to appropriate agencies.
Domain Names used for collecting scam email ("Honeypot email accounts") have been obscured and replaced with the token 'HUN1P0T'
Community Action - SPAM/non-Scam Report
Occasionally, incorrectly categorized emails get into the Scamdex Scam Email Database and need to be removed. If this
email has Personally Identifiable Information (PII), or is, in your opinion, from a bona-fide entity, let us know.
Scamdex will, as soon as is practicable, take-down any emails that in our opinion should not
be in our database. Note that ALL emails in the Scamdex Scam Email Database were received as Unsolicited Commercial Email, aka UCE or
SPAM, via unpublished 'Honeypot' email addresses.
Dear Lucky Winner!
We are pleased to inform you of the result of the PEOPLE'S POSTCODE ONLINE EMAIL LOTTERY PROMOTION,
an international program held on the 21th of SEPT 2016, in which your e-mail address was attached
to the following winning information's have won Â825,000.00 GBP in the on-going Int'l Draw Promo.
Ticket Number: 2747-3600-2016 166
Batch Number: BBSTA/8813/KL/AS
Reference Number: AAP/20/17/44/2016/KL
To files for your claims, please contact the payment office through the below email address later
five (5)days from today afterwhich all funds will be returned as unclaimed. Send your details to
online admin such as Full Name, Mobile No, Mail ID, Sex, Address, Country, Age, Occupation via
email: [
agentclaims@europe.com]
Best Regards
Mrs. Mable Anderson
Dear Lucky Winner!
We are pleased to inform you of the result of the PEOPLE'S POSTCODE ONLINE EMAIL LOTTERY PROMOTION,
an international program held on the 21th of SEPT 2016, in which your e-mail address was attached
to the following winning information's have won Â825,000.00 GBP in the on-going Int'l Draw Promo.
Ticket Number: 2747-3600-2016 166
Batch Number: BBSTA/8813/KL/AS
Reference Number: AAP/20/17/44/2016/KL
To files for your claims, please contact the payment office through the below email address later
five (5)days from today afterwhich all funds will be returned as unclaimed. Send your details to
online admin such as Full Name, Mobile No, Mail ID, Sex, Address, Country, Age, Occupation via
email: [
agentclaims@europe.com]
Best Regards
Mrs. Mable Anderson
What Is This?
This Email with the Subject "Dear Lucky Winner" was
received in one of Scamdex's honeypot email accounts on Sat, 01 Oct 2016 09:02:06 -0400 and has been classified as a
Lotto/Lottery Scam Email. The sender shows as peoplelottery <cmeivilaverde@sme.curitiba.pr.gov.br>,
although that address was probably spoofed. We recommend that you do not attempt to contact any persons or organizations referenced in
this email, as you may expose yourself to scammers and, at the very least, you will be added to their email address lists for spam purposes.
Since you’re here …
we have a small favour to ask. More people are visting Scamdex and Scamalot than ever but advertising revenues are falling fast and we have no 'product' to sell.
And unlike many informational websites, we haven’t put up a paywall or membership barrier – we want to keep our site as open as we can.
So you can see why we need to ask for your help. Scamdex/Scamalot websites takes a lot of time, money and hard work to keep running. We do this because we
hate to see our fellow humans getting scammed out of their hard-earned money by low-lives.
Consider switching off your AdBlocker (if you use one) or contributing directly by one of the links below. Thank you for reading!
